Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

hydroxysteroid (17-beta) dehydrogenase 12 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant HSD17B12.

Manufacturer:  Abnova Corporation H00051144A01

Catalog No. 89-004-621


Add to cart

Description

Description

The enzyme 17-beta hydroxysteroid dehydrogenase-12 (HSD17B12) uses NADPH to reduce 3-ketoacyl-CoA to 3-hydroxyacyl-CoA during the second step of fatty acid elongation.[supplied by OMIM

Sequence: SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG
Specifications

Specifications

hydroxysteroid (17-beta) dehydrogenase 12
Unconjugated
50% glycerol
NM_016142
KAR|SDR12C1
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
51144
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant HSD17B12.
HSD17B12
Serum
HSD17B12
HSD17B12 (NP_057226, 203 a.a. ~ 271 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit