heat shock transcription factor 4, Mouse, Clone: 3G3, Abnova™

Catalog No.	Quantity
89-000-736	100 μg

Catalog No. 89-000-736 Supplier Abnova Corporation Supplier No. H00003299M03

Description

Mouse monoclonal antibody raised against a partial recombinant HSF4.

Heat-shock transcription factors (HSFs) activate heat-shock response genes under conditions of heat or other stresses. HSF4 lacks the carboxyl-terminal hydrophobic repeat which is shared among all vertebrate HSFs and has been suggested to be involved in the negative regulation of DNA binding activity. Two alternatively spliced transcripts encoding distinct isoforms and possessing different transcriptional activity have been described. [provided by RefSeq

Sequence: KVPALRGDDGRWRPEDLGRLLGEVQALRGVQESTEARLRELRQQNEILWREVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSC

Specifications

• Antigen: heat shock transcription factor 4
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3G3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant HSF4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: HSF4
• Gene Accession No.: NM_001538
• Gene Alias: CTM
• Gene Symbols: HSF4
• Host Species: Mouse
• Immunogen: HSF4 (NP_001529, 121 a.a. ∼ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3299
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ