HSPA1L, Mouse, Clone: 1B5, Abnova™

Catalog No.	Quantity
89-123-158	100 μg

Catalog No. 89-123-158 Supplier Abnova Corporation Supplier No. H00003305M01

Description

Mouse monoclonal antibody raised against a partial recombinant HSPA1L.

This gene encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein. [provided by RefSeq

Sequence: KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD

Specifications

• Antigen: HSPA1L
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1B5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant HSPA1L.
• Formulation: PBS with no preservative; pH 7.4
• Gene: HSPA1L
• Gene Accession No.: NM_005527
• Gene Alias: HSP70-1L/HSP70-HOM/HSP70T/hum70t
• Gene Symbols: HSPA1L
• Host Species: Mouse
• Immunogen: HSPA1L (NP_005518, 561 a.a. ∼ 641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3305
• Target Species: Human, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ