HSPB8, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-141	50 μL

Catalog No. 89-003-141 Supplier Abnova Corporation Supplier No. H00026353A01

Description

Mouse polyclonal antibody raised against a full-length recombinant HSPB8.

The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. [provided by RefSeq

Sequence: MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT

Specifications

• Antigen: HSPB8
• Applications: ELISA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length recombinant HSPB8.
• Formulation: 50% glycerol
• Gene: HSPB8
• Gene Accession No.: BC002673
• Gene Alias: CMT2L/DHMN2/E2IG1/H11/HMN2/HMN2A/HSP22
• Gene Symbols: HSPB8
• Host Species: Mouse
• Immunogen: HSPB8 (AAH02673.1, 1 a.a. ∼ 196 a.a) full-length recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 26353
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid