heat shock 22kDa protein 8, Mouse, Clone: 5D7, Abnova™

Catalog No.	Quantity
89-001-242	100 μg

Catalog No. 89-001-242 Supplier Abnova Corporation Supplier No. H00026353M02

Description

Mouse monoclonal antibody raised against a partial recombinant HSPB8.

The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. [provided by RefSeq

Sequence: KVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT

Specifications

• Antigen: heat shock 22kDa protein 8
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 5D7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant HSPB8.
• Formulation: PBS with no preservative; pH 7.4
• Gene: HSPB8
• Gene Accession No.: NM_014365
• Gene Alias: CMT2L/DHMN2/E2IG1/H11/HMN2/HMN2A/HSP22
• Gene Symbols: HSPB8
• Host Species: Mouse
• Immunogen: HSPB8 (NP_055180, 97 a.a. ∼ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 26353
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ