Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89018483

NOP16 nucleolar protein homolog (yeast), Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No. 89018483 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-018-483 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-018-483 Supplier Abnova Corporation Supplier No. H00051491D01P
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against a full-length human HSPC111 protein.

NOP16 is transcriptionally regulated by c-Myc (MYC; MIM 190080), upregulated in breast cancer, and overexpression is associated with poor patient survival (Butt et al., 2008).[supplied by OMIM

Sequence: MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE

Specifications

Antigen NOP16 nucleolar protein homolog (yeast)
Applications Immunofluorescence, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against a full-length human HSPC111 protein.
Formulation PBS with no preservative; pH 7.4
Gene NOP16
Gene Accession No. BC040106
Gene Alias HSPC111/HSPC185
Gene Symbols NOP16
Host Species Rabbit
Immunogen HSPC111 (AAH40106.1, 1 a.a. ∼ 178 a.a) full-length human protein.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Stem Cell Biology
Primary or Secondary Primary
Gene ID (Entrez) 51491
Target Species Human, Mouse
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.