NOP16 nucleolar protein homolog (yeast), Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human HSPC111 protein.

Supplier:  Abnova Corporation H00051491D01P

Catalog No. 89-018-483

Description

NOP16 is transcriptionally regulated by c-Myc (MYC; MIM 190080), upregulated in breast cancer, and overexpression is associated with poor patient survival (Butt et al., 2008).[supplied by OMIM

Sequence: MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE

Specifications

• Antigen: NOP16 nucleolar protein homolog (yeast)
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human HSPC111 protein.
• Gene: NOP16
• Gene Alias: HSPC111/HSPC185
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody

• Applications: Immunofluorescence, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC040106
• Gene Symbols: NOP16
• Immunogen: HSPC111 (AAH40106.1, 1 a.a. ∼ 178 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Stem Cell Biology
• Gene ID (Entrez): 51491
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG