Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004161

5-hydroxytryptamine (serotonin) receptor 2B, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004161 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-161 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-161 Supplier Abnova Corporation Supplier No. H00003357A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant HTR2B.

Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognized. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets; central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens.[supplied by OMIM

Sequence: MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHW

Specifications

Antigen 5-hydroxytryptamine (serotonin) receptor 2B
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant HTR2B.
Formulation 50% glycerol
Gene HTR2B
Gene Accession No. NM_000867
Gene Alias 5-HT(2B)/5-HT2B
Gene Symbols HTR2B
Host Species Mouse
Immunogen HTR2B (NP_000858, 1 a.a. ∼ 56 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Membrane Receptors
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 3357
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.