HTR2C, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-006	50 μL

Catalog No. 89-003-006 Supplier Abnova Corporation Supplier No. H00003358A01

Description

Mouse polyclonal antibody raised against a partial recombinant HTR2C.

Serotonin (5-hydroxytryptamine, 5-HT), a neurotransmitter, elicits a wide array of physiological effects by binding to several receptor subtypes, including the 5-HT2 family of seven-transmembrane-spanning, G-protein-coupled receptors, which activate phospholipase C and D signaling pathways. This gene encodes the 2C subtype of serotonin receptor and its mRNA is subject to multiple RNA editing events, where genomically encoded adenosine residues are converted to inosines. RNA editing is predicted to alter amino acids within the second intracellular loop of the 5-HT2C receptor and generate receptor isoforms that differ in their ability to interact with G proteins and the activation of phospholipase C and D signaling cascades, thus modulating serotonergic neurotransmission in the central nervous system. Studies in humans have reported abnormalities in patterns of 5-HT2C editing in depressed suicide victims. [provided by RefSeq

Sequence: MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGV

Specifications

• Antigen: HTR2C
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant HTR2C.
• Formulation: 50% glycerol
• Gene: HTR2C
• Gene Accession No.: NM_000868
• Gene Alias: 5-HT2C/5-HTR2C/HTR1C
• Gene Symbols: HTR2C
• Host Species: Mouse
• Immunogen: HTR2C (NP_000859, 1 a.a. ∼ 52 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3358
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid