HtrA serine peptidase 2, Mouse, Clone: 4F10, Abnova™

Catalog No.	Quantity
89-001-255	100 μg

Catalog No. 89-001-255 Supplier Abnova Corporation Supplier No. H00027429M02

Description

Mouse monoclonal antibody raised against a partial recombinant HTRA2.

This gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed. Alternate splicing of this gene results in two transcript variants encoding different isoforms. Additional transcript variants have been described, but their full-length sequences have not been determined. [provided by RefSeq

Sequence: RRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE

Specifications

• Antigen: HtrA serine peptidase 2
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 4F10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant HTRA2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: HTRA2
• Gene Accession No.: BC000096
• Gene Alias: OMI/PARK13/PRSS25
• Gene Symbols: HTRA2
• Host Species: Mouse
• Immunogen: HTRA2 (AAH00096, 359 a.a. ∼ 458 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 27429
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ