inhibitor of DNA binding 1, dominant negative helix-loop-helix protein, Mouse, Clone: 1F7, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant ID1.

Supplier:  Abnova Corporation H00003397M02

Catalog No. 89-014-128

Description

The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

Specifications

• Antigen: inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC000613
• Gene Symbols: ID1
• Immunogen: ID1 (AAH00613.1, 1 a.a. ∼ 155 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Stem Cell Biology
• Gene ID (Entrez): 3397
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence, KnockDown, Western Blot
• Clone: 1F7
• Description: Mouse monoclonal antibody raised against a full length recombinant ID1.
• Gene: ID1
• Gene Alias: ID/bHLHb24
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody