inhibitor of DNA binding 1, dominant negative helix-loop-helix protein, Mouse, Clone: 1F7, Abnova™

Catalog No.	Quantity
89-014-128	100 μg

Catalog No. 89-014-128 Supplier Abnova Corporation Supplier No. H00003397M02

Description

Mouse monoclonal antibody raised against a full-length recombinant ID1.

The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

Specifications

• Antigen: inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
• Applications: ELISA, Immunofluorescence, KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 1F7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant ID1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ID1
• Gene Accession No.: BC000613
• Gene Alias: ID/bHLHb24
• Gene Symbols: ID1
• Host Species: Mouse
• Immunogen: ID1 (AAH00613.1, 1 a.a. ∼ 155 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Stem Cell Biology
• Primary or Secondary: Primary
• Gene ID (Entrez): 3397
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ