Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

inhibitor of DNA binding 1, dominant negative helix-loop-helix protein, Mouse, Clone: 4G11, Abnova™

Catalog No. 89000739 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-739 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-739 Supplier Abnova Corporation Supplier No. H00003397M04
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant ID1.

The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

Specifications

Antigen inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 4G11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant ID1.
Formulation PBS with no preservative; pH 7.4
Gene ID1
Gene Accession No. BC000613
Gene Alias ID/bHLHb24
Gene Symbols ID1
Host Species Mouse
Immunogen ID1 (AAH00613.1, 1 a.a. ∼ 155 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Stem Cell Biology
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 3397
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.