inhibitor of DNA binding 2, dominant negative helix-loop-helix protein, Mouse, Clone: 2C11, Abnova™

Catalog No.	Quantity
89-000-740	100 μg

Catalog No. 89-000-740 Supplier Abnova Corporation Supplier No. H00003398M04

Description

Mouse monoclonal antibody raised against a full-length recombinant ID2.

The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. [provided by RefSeq

Sequence: MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG

Specifications

• Antigen: inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2C11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant ID2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ID2
• Gene Accession No.: BC030639
• Gene Alias: GIG8/ID2A/ID2H/MGC26389/bHLHb26
• Gene Symbols: ID2
• Host Species: Mouse
• Immunogen: ID2 (AAH30639, 1 a.a. ∼ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3398
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ