inhibitor of DNA binding 2, dominant negative helix-loop-helix protein, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-017-749	100 μg

Catalog No. 89-017-749 Supplier Abnova Corporation Supplier No. H00003398D03P

Description

Rabbit polyclonal antibody raised against a full-length human ID2 protein.

The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. [provided by RefSeq

Sequence: MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG

Specifications

• Antigen: inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human ID2 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ID2
• Gene Accession No.: BC030639
• Gene Alias: GIG8/ID2A/ID2H/MGC26389/bHLHb26
• Gene Symbols: ID2
• Host Species: Rabbit
• Immunogen: ID2 (AAH30639, 1 a.a. ∼ 134 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3398
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG