Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014130

inhibitor of DNA binding 3, dominant negative helix-loop-helix protein, Mouse, Clone: 4G1, Abnova™

Catalog No. 89014130 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-130 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-130 Supplier Abnova Corporation Supplier No. H00003399M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant ID3.

Members of the ID family of helix-loop-helix (HLH) proteins lack a basic DNA-binding domain and inhibit transcription through formation of nonfunctional dimers that are incapable of binding to DNA.[supplied by OMIM

Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV

Specifications

Antigen inhibitor of DNA binding 3, dominant negative helix-loop-helix protein
Applications ELISA, KnockDown, Western Blot
Classification Monoclonal
Clone 4G1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ID3.
Formulation PBS with no preservative; pH 7.4
Gene ID3
Gene Accession No. NM_002167
Gene Alias HEIR-1/bHLHb25
Gene Symbols ID3
Host Species Mouse
Immunogen ID3 (NP_002158, 1 a.a. ∼ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Primary or Secondary Primary
Gene ID (Entrez) 3399
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.