inhibitor of DNA binding 3, dominant negative helix-loop-helix protein, Mouse, Clone: 4G1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ID3.

Supplier:  Abnova Corporation H00003399M01

Catalog No. 89-014-130

Description

Members of the ID family of helix-loop-helix (HLH) proteins lack a basic DNA-binding domain and inhibit transcription through formation of nonfunctional dimers that are incapable of binding to DNA.[supplied by OMIM

Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV

Specifications

• Antigen: inhibitor of DNA binding 3, dominant negative helix-loop-helix protein
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_002167
• Gene Symbols: ID3
• Immunogen: ID3 (NP_002158, 1 a.a. ∼ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Gene ID (Entrez): 3399
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, KnockDown, Western Blot
• Clone: 4G1
• Description: Mouse monoclonal antibody raised against a partial recombinant ID3.
• Gene: ID3
• Gene Alias: HEIR-1/bHLHb25
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody