isocitrate dehydrogenase 2 (NADP+), mitochondrial, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-164	50 μL

Catalog No. 89-004-164 Supplier Abnova Corporation Supplier No. H00003418A01

Description

Mouse polyclonal antibody raised against a partial recombinant IDH2.

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. [provided by RefSeq]

Sequence: HYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGR

Specifications

• Antigen: isocitrate dehydrogenase 2 (NADP+), mitochondrial
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant IDH2.
• Formulation: 50% glycerol
• Gene: IDH2
• Gene Accession No.: NM_002168
• Gene Alias: ICD-M/IDH/IDHM/IDP/IDPM/mNADP-IDH
• Gene Symbols: IDH2
• Host Species: Mouse
• Immunogen: IDH2 (NP_002159, 354 a.a. ∼ 451 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3418
• Test Specificity: This antibody cross-reacts with human IDH1.
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum