Indian hedgehog homolog (Drosophila), Mouse, Clone: 2G9, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant IHH.

Supplier:  Abnova Corporation H00003549M01

Catalog No. 89-000-746

Description

Sequence: ESGARVALSAVRPGDRVLAMGEDGSPTFSDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQPGQYVLVAGVPG

Specifications

• Antigen: Indian hedgehog homolog (Drosophila)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC034757
• Gene Symbols: IHH
• Immunogen: IHH (AAH34757, 119 a.a. ∼ 217 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 3549
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 2G9
• Description: Mouse monoclonal antibody raised against a full length recombinant IHH.
• Gene: IHH
• Gene Alias: BDA1/HHG2
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody