inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta, Mouse, Clone: 1A3, Abnova™

Catalog No.	Quantity
89-000-747	100 μg

Catalog No. 89-000-747 Supplier Abnova Corporation Supplier No. H00003551M04

Description

Mouse monoclonal antibody raised against a partial recombinant IKBKB.

NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB, MIM 604495), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664, or IKBKB) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM

Sequence: WSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG

Specifications

• Antigen: inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
• Applications: ELISA, In situ PLA, Western Blot
• Classification: Monoclonal
• Clone: 1A3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant IKBKB.
• Formulation: PBS with no preservative; pH 7.4
• Gene: IKBKB
• Gene Accession No.: BC006231
• Gene Alias: FLJ40509/IKK-beta/IKK2/IKKB/MGC131801/NFKBIKB
• Gene Symbols: IKBKB
• Host Species: Mouse
• Immunogen: IKBKB (AAH06231, 3 a.a. ∼ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3551
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ