interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant IL12B.

Supplier:  Abnova Corporation H00003593A01

Catalog No. 89-004-167

Description

This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40kDa cytokine receptor like subunit encoded by this gene, and a 35kDa subunit encoded by IL12A. This cytokine is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. This cytokine has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. Overexpression of this gene was observed in the central nervous system of patients with multiple sclerosis (MS), suggesting a role of this cytokine in the pathogenesis of the disease. The promoter polymorphism of this gene has been reported to be associated with the severity of atopic and nonatopic asthma in children. [provided by RefSeq

Sequence: IRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Specifications

• Antigen: interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant IL12B.
• Gene: IL12B
• Gene Alias: CLMF/CLMF2/IL-12B/NKSF/NKSF2
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_002187
• Gene Symbols: IL12B
• Immunogen: IL12B (NP_002178, 229 a.a. ∼ 328 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 3593
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.