interleukin 15, Mouse, Clone: 2F6, Abnova™

Catalog No.	Quantity
89-000-753	100 μg

Catalog No. 89-000-753 Supplier Abnova Corporation Supplier No. H00003600M13

Description

Mouse monoclonal antibody raised against a full-length recombinant IL15.

The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported. [provided by RefSeq]

Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Specifications

• Antigen: interleukin 15
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 2F6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant IL15.
• Formulation: PBS with no preservative; pH 7.4
• Gene: IL15
• Gene Accession No.: NM_000585
• Gene Alias: IL-15/MGC9721
• Gene Symbols: IL15
• Host Species: Mouse
• Immunogen: IL15 (NP_000576, 49 a.a. ∼ 162 a.a) full length recombinant protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3600
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ