Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IL1A, Mouse, Clone: 4F9, Abnova™

Catalog No. 89123162 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-162 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-123-162 Supplier Abnova Corporation Supplier No. H00003552M04
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant IL1A.

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. [provided by RefSeq]

Sequence: KSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

Specifications

Antigen IL1A
Applications ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 4F9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant IL1A.
Formulation PBS with no preservative; pH 7.4
Gene IL1A
Gene Accession No. BC013142
Gene Alias IL-1A/IL1/IL1-ALPHA/IL1F1
Gene Symbols IL1A
Host Species Mouse
Immunogen IL1A (AAH13142, 172 a.a. ∼ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3552
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.