IL1B, Rabbit, MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human IL1B protein.

Supplier:  Abnova Corporation H00003553D01

Catalog No. 89-002-898

Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq

Sequence: MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Specifications

• Antigen: IL1B
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human IL1B protein.
• Gene: IL1B
• Gene Alias: IL-1/IL1-BETA/IL1F2
• Host Species: Rabbit
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Liquid

• Applications: Immunoprecipitation, Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_000576
• Gene Symbols: IL1B
• Immunogen: IL1B (AAH08678.1, 1 a.a. ∼ 269 a.a) full-length human protein.
• Regulatory Status: RUO
• Gene ID (Entrez): 3553
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.