IL1B, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-008	50 μL

Catalog No. 89-003-008 Supplier Abnova Corporation Supplier No. H00003553A01

Description

Mouse polyclonal antibody raised against a partial recombinant IL1B.

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq

Sequence: DKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Specifications

• Antigen: IL1B
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant IL1B.
• Formulation: 50% glycerol
• Gene: IL1B
• Gene Accession No.: BC008678
• Gene Alias: IL-1/IL1-BETA/IL1F2
• Gene Symbols: IL1B
• Host Species: Mouse
• Immunogen: IL1B (AAH08678, 170 a.a. ∼ 269 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3553
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid