interleukin 1 receptor, type I, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant IL1R1.

Supplier:  Abnova Corporation H00003554A01

Catalog No. 89-004-166

Description

The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This protein is a receptor for interleukin alpha (IL1A), interleukin beta (IL1B), and interleukin 1 receptor, type I(IL1R1/IL1RA). It is an important mediator involved in many cytokine induced immune and inflammatory responses. This gene along with interleukin 1 receptor, type II (IL1R2), interleukin 1 receptor-like 2 (IL1RL2), and interleukin 1 receptor-like 1 (IL1RL1) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. [provided by RefSeq

Sequence: LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAI

Specifications

• Antigen: interleukin 1 receptor, type I
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant IL1R1.
• Gene: IL1R1
• Gene Alias: CD121A/D2S1473/IL-1R-alpha/IL1R/IL1RA/P80
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_000877
• Gene Symbols: IL1R1
• Immunogen: IL1R1 (NP_000868, 18 a.a. ∼ 127 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 3554
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.