interleukin 22 receptor, alpha 1, Mouse, Clone: 2E6, Abnova™

Catalog No.	Quantity
89-001-335	100 μg

Catalog No. 89-001-335 Supplier Abnova Corporation Supplier No. H00058985M01

Description

Mouse monoclonal antibody raised against a partial recombinant IL22RA1.

The protein encoded by this gene belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CRFB4), a subunit also shared by the receptor complex for interleukin 10 (IL10). This gene and interleukin 28 receptor, alpha (IL28RA) form a cytokine receptor gene cluster in the chromosomal region 1p36. [provided by RefSeq

Sequence: MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMT

Specifications

• Antigen: interleukin 22 receptor, alpha 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2E6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant IL22RA1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: IL22RA1
• Gene Accession No.: NM_021258
• Gene Alias: CRF2-9/IL22R/IL22R1
• Gene Symbols: IL22RA1
• Host Species: Mouse
• Immunogen: IL22RA1 (NP_067081, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 58985
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ