Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89018484

interleukin 23, alpha subunit p19, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No. 89018484 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-018-484 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-018-484 Supplier Abnova Corporation Supplier No. H00051561D01P
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against a full-length human IL23A protein.

This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells. [provided by RefSeq]

Sequence: MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Specifications

Antigen interleukin 23, alpha subunit p19
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against a full-length human IL23A protein.
Formulation PBS with no preservative; pH 7.4
Gene IL23A
Gene Accession No. NM_016584
Gene Alias IL-23/IL-23A/IL23P19/MGC79388/P19/SGRF
Gene Symbols IL23A
Host Species Rabbit
Immunogen IL23A (NP_057668.1, 1 a.a. ∼ 189 a.a) full-length human protein.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cytokines
Primary or Secondary Primary
Gene ID (Entrez) 51561
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.