interleukin 27, Mouse, Clone: 3F12, Abnova™

Catalog No.	Quantity
89-014-352	100 μg

Catalog No. 89-014-352 Supplier Abnova Corporation Supplier No. H00246778M01

Description

Mouse monoclonal antibody raised against a partial recombinant IL27.

The protein encoded by this gene is one of the subunits of a heterodimeric cytokine complex. This protein is related to interleukin 12A (IL12A). It interacts with Epstein-Barr virus induced gene 3 (EBI3), a protein similar to interleukin 12B (IL12B), and forms a complex that has been shown to drive rapid expansion of naive but not memory CD4(+) T cells. The complex is also found to synergize strongly with interleukin 12 to trigger interferon gamma (IFNG) production of naive CD4(+) T cells. The biological effects of this cytokine are mediated by the class I cytokine receptor (WSX1/TCRR). [provided by RefSeq]

Sequence: RKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP

Specifications

• Antigen: interleukin 27
• Applications: ELISA, Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: 3F12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant IL27.
• Formulation: PBS with no preservative; pH 7.4
• Gene: IL27
• Gene Accession No.: NM_145659
• Gene Alias: IL-27/IL-27A/IL27p28/IL30/MGC71873/p28
• Gene Symbols: IL27
• Host Species: Mouse
• Immunogen: IL27 (NP_663634, 177 a.a. ∼ 243 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Gene ID (Entrez): 246778
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ