interleukin 28 receptor, alpha (interferon, lambda receptor), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-808	50 μL

Catalog No. 89-004-808 Supplier Abnova Corporation Supplier No. H00163702A01

Description

Mouse polyclonal antibody raised against a partial recombinant IL28RA.

The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq

Sequence: QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPC

Specifications

• Antigen: interleukin 28 receptor, alpha (interferon, lambda receptor)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant IL28RA.
• Formulation: 50% glycerol
• Gene: IL28RA
• Gene Accession No.: NM_170743
• Gene Alias: CRF2/12/IFNLR/IFNLR1/IL-28R1/LICR2
• Gene Symbols: IL28RA
• Host Species: Mouse
• Immunogen: IL28RA (NP_734464, 51 a.a. ∼ 150 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 163702
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum