Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IL32, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human IL32 protein.

Manufacturer:  Abnova Corporation H00009235B01

Catalog No. 89-006-733


Add to cart

Description

Description

This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK
Specifications

Specifications

IL32
Unconjugated
No additive
NM_001012631.1
IL-32alpha|IL-32beta|IL-32delta|IL-32gamma|NK4|TAIF|TAIFa|TAIFb|TAIFc|TAIFd
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
9235
Western Blot
Mouse polyclonal antibody raised against a full-length human IL32 protein.
IL32
Serum
IL32
IL32 (NP_001012649.1, 1 a.a. ~ 188 a.a) full-length human protein.
RUO
Y
Polyclonal
Human
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit