IL4, Mouse, Clone: 3D11, Abnova™

Catalog No.	Quantity
89-123-168	100 μg

Catalog No. 89-123-168 Supplier Abnova Corporation Supplier No. H00003565M01

Description

Mouse monoclonal antibody raised against a partial recombinant IL4.

The protein encoded by this gene is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine. This gene, IL3, IL5, IL13, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL13. This gene, IL13 and IL5 are found to be regulated coordinately by several long-range regulatory elements in an over 120 kilobase range on the chromosome. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq

Sequence: TTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

Specifications

• Antigen: IL4
• Applications: ELISA
• Classification: Monoclonal
• Clone: 3D11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant IL4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: IL4
• Gene Accession No.: NM_000589
• Gene Alias: BCGF-1/BCGF1/BSF1/IL-4/MGC79402
• Gene Symbols: IL4
• Host Species: Mouse
• Immunogen: IL4 (NP_000580, 63 a.a. ∼ 153 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3565
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ