interleukin 6 (interferon, beta 2), Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human IL6 protein.

Manufacturer: Abnova Corporation H00003569D01P

Catalog No. 89-017-771

  Check Availability
Add to Cart

    Specifications

    Antigen interleukin 6 (interferon, beta 2)
    Applications Western Blotting
    Conjugate Unlabeled
    Cross Reactivity Human
    Description interleukin 6 (interferon, beta 2)
    Format Affinity Purified
    Formulation In 1X PBS, pH 7.4
    Gene IL6
    Gene Accession No. NM_000600
    Gene Alias BSF2, HGF, HSF, IFNB2, IL-6
    Gene Symbols IL6
    Host Species Rabbit
    Immunogen IL6 (AAH15511.1, 1 a.a. ∽212 a.a) full-length human protein.
    Purification Method Protein A column
    Quantity 100μg
    Regulatory Status RUO
    Research Discipline Cell Cycle
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Polyclonal
    Gene ID (Entrez) 3569

    This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. [provided by RefSeq

    Sequence: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit