Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

interleukin 6 (interferon, beta 2), Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human IL6 protein.

Manufacturer:  Abnova Corporation H00003569D01P

Catalog No. 89-017-771


  Check Availability
Add to cart

Specifications

Description

This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. [provided by RefSeq

Sequence: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Description & Specifications

Specifications

interleukin 6 (interferon, beta 2)
Unlabeled
In 1X PBS, pH 7.4
NM_000600
BSF2, HGF, HSF, IFNB2, IL-6
Rabbit
Protein A column
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Western Blot
interleukin 6 (interferon, beta 2)
IL6
Affinity Purified
IL6
IL6 (AAH15511.1, 1 a.a. ∽212 a.a) full-length human protein.
100μg
Cell Cycle
Primary
3569
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit