Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IL8, Mouse, Clone: 1A3, Abnova™

Catalog No. 89123189 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-189 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-123-189 Supplier Abnova Corporation Supplier No. H00003576M17
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant IL8.

The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. [provided by RefSeq

Sequence: EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Specifications

Antigen IL8
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 1A3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant IL8.
Formulation PBS with no preservative; pH 7.4
Gene IL8
Gene Accession No. BC013615
Gene Alias CXCL8/GCP-1/GCP1/LECT/LUCT/LYNAP/MDNCF/MONAP/NAF/NAP-1/NAP1
Gene Symbols IL8
Host Species Mouse
Immunogen IL8 (AAH13615, 21 a.a. ∼ 99 a.a) full length recombinant protein.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3576
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.