IL8, Mouse, Clone: 1B4, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant IL8.

Supplier:  Abnova Corporation H00003576M16

Catalog No. 89-123-188

Description

The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. [provided by RefSeq

Sequence: EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Specifications

• Antigen: IL8
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC013615
• Gene Symbols: IL8
• Immunogen: IL8 (AAH13615, 21 a.a. ∼ 99 a.a) full length recombinant protein.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Immunoprecipitation, Western Blot
• Clone: 1B4
• Description: Mouse monoclonal antibody raised against a full length recombinant IL8.
• Gene: IL8
• Gene Alias: CXCL8/GCP-1/GCP1/LECT/LUCT/LYNAP/MDNCF/MONAP/NAF/NAP-1/NAP1
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 3576
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid