Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

indoleamine 2,3-dioxygenase 1, Mouse, Clone: 4F9, Abnova™

Catalog No. 89000754 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-754 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-754 Supplier Abnova Corporation Supplier No. H00003620M07
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant IDO1.

Gamma-interferon (IFNG; MIM 147570) has an antiproliferative effect on many tumor cells and inhibits intracellular pathogens such as Toxoplasma and Chlamydia, at least partly because of the induction of indoleamine 2,3-dioxygenase (INDO; EC 1.13.11.52). This enzyme catalyzes the degradation of the essential amino acid L-tryptophan to N-formyl-kynurenine.[supplied by OMIM

Sequence: RNFLCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLKTVRSTTEKSLLKEG

Specifications

Antigen indoleamine 2,3-dioxygenase 1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4F9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant IDO1.
Formulation PBS with no preservative; pH 7.4
Gene IDO1
Gene Accession No. NM_002164
Gene Alias CD107B/IDO/INDO
Gene Symbols IDO1
Host Species Mouse
Immunogen IDO1 (NP_002155, 304 a.a. ∼ 403 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 3620
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.