inhibitor of growth family, member 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-005-642	50 μL

Catalog No. 89-005-642 Supplier Abnova Corporation Supplier No. H00003621B01

Description

Mouse polyclonal antibody raised against a full-length human ING1 protein.

This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq

Sequence: MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR

Specifications

• Antigen: inhibitor of growth family, member 1
• Applications: Immunofluorescence, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human ING1 protein.
• Formulation: No additive
• Gene: ING1
• Gene Accession No.: NM_198219
• Gene Alias: p24ING1c/p33/p33ING1/p33ING1b/p47/p47ING1a
• Gene Symbols: ING1
• Host Species: Mouse
• Immunogen: ING1 (NP_937862, 1 a.a. ∼ 279 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3621
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum