inositol polyphosphate-5-phosphatase, 40kDa, Mouse, Clone: 3D8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant INPP5A.

Supplier:  Abnova Corporation H00003632M05

Catalog No. 89-014-133

Description

The protein encoded by this gene is a membrane-associated type I inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation. [provided by RefSeq

Sequence: YFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRVSVCCPSPGHRGMWSAGSGLAQPW

Specifications

• Antigen: inositol polyphosphate-5-phosphatase, 40kDa
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_005539
• Gene Symbols: INPP5A
• Immunogen: INPP5A (NP_005530, 288 a.a. ∼ 387 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunoprecipitation, Western Blot
• Clone: 3D8
• Description: Mouse monoclonal antibody raised against a partial recombinant INPP5A.
• Gene: INPP5A
• Gene Alias: 5PTASE/DKFZp434A1721/MGC116947/MGC116949
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3632
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ