INSIG-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP160007

Catalog No. NBP160007

Description

INSIG-2 Polyclonal specifically detects INSIG-2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: INSIG-2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: INSIG-2, INSIG2 membrane protein, insulin induced gene 2, insulin induced protein 2, insulin-induced gene 2 protein, MGC26273
• Host Species: Rabbit
• Molecular Weight of Antigen: 25 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9Y5U4
• Gene Symbols: INSIG2
• Immunogen: Synthetic peptides corresponding to INSIG2(insulin induced gene 2) The peptide sequence was selected from the N terminal of INSIG2. Peptide sequence MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51141
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Goat, Rabbit, Sheep
• Isotype: IgG

For Research Use Only