pancreatic and duodenal homeobox 1, Mouse, Clone: 3F10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant IPF1.

Supplier:  Abnova Corporation H00003651M01

Catalog No. 89-000-757

Description

The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4). [provided by RefSeq

Sequence: LEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKK

Specifications

• Antigen: pancreatic and duodenal homeobox 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_000209
• Gene Symbols: PDX1
• Immunogen: IPF1 (NP_000200, 109 a.a. ∼ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 3F10
• Description: Mouse monoclonal antibody raised against a partial recombinant IPF1.
• Gene: PDX1
• Gene Alias: GSF/IDX-1/IPF1/IUF1/MODY4/PDX-1/STF-1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 3651
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b λ