Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000759

interleukin-1 receptor-associated kinase 2, Mouse, Clone: 3H1, Abnova™

Catalog No. 89000759 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-759 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-759 Supplier Abnova Corporation Supplier No. H00003656M03
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant IRAK2.

IRAK2 encodes the interleukin-1 receptor-associated kinase 2, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. IRAK2 is reported to participate in the IL1-induced upregulation of NF-kappaB. [provided by RefSeq

Sequence: KPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDF

Specifications

Antigen interleukin-1 receptor-associated kinase 2
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3H1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant IRAK2.
Formulation PBS with no preservative; pH 7.4
Gene IRAK2
Gene Accession No. NM_001570
Gene Alias IRAK-2/MGC150550
Gene Symbols IRAK2
Host Species Mouse
Immunogen IRAK2 (NP_001561, 111 a.a. ∼ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 3656
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.