Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000760

interferon regulatory factor 2, Mouse, Clone: 3D6, Abnova™

Catalog No. 89000760 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-760 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-760 Supplier Abnova Corporation Supplier No. H00003660M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant IRF2.

IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4. [provided by RefSeq

Sequence: MSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSS

Specifications

Antigen interferon regulatory factor 2
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 3D6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant IRF2.
Formulation PBS with no preservative; pH 7.4
Gene IRF2
Gene Accession No. NM_002199
Gene Alias DKFZp686F0244/IRF-2
Gene Symbols IRF2
Host Species Mouse
Immunogen IRF2 (NP_002190, 216 a.a. ∼ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 3660
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.