Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

iroquois homeobox 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant IRX1.

Manufacturer:  Abnova Corporation H00079192A01

Catalog No. 89-004-719


Add to cart

Description

Description

IRX1 is a member of the Iroquois homeobox gene family. Members of this family appear to play multiple roles during pattern formation of vertebrate embryos.[supplied by OMIM

Sequence: NGDKASVRSSPTLPERDLVPRPDSPAQQLKSPFQPVRDNSLAPQEGTPRILAALPS
Specifications

Specifications

iroquois homeobox 1
Unconjugated
50% glycerol
NM_024337
IRX-5|IRXA1
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
79192
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant IRX1.
IRX1
Serum
IRX1
IRX1 (NP_077313, 424 a.a. ~ 479 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit