inositol-3-phosphate synthase 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ISYNA1.

Supplier:  Abnova Corporation H00051477A01

Catalog No. 89-004-631

Description

Myoinositol, the most common naturally occurring form of inositol, is a component of plasma membrane phospholipids and functions as a cell signaling molecule. ISYNA1 (EC 5.5.1.4), or IPS, is a rate-limiting enzyme that catalyzes the de novo synthesis of myoinositol 1-phosphate from glucose 6-phosphate (Seelan et al., 2004 [PubMed 15464731]).[supplied by OMIM

Sequence: SYNHLGNNDGENLSAPLQFRSKEVSKSNVVDDMVQSNPVLYTPGEEPDHCVVIKYVPYVGDSKRALDEYTSELMLGGTNTLVLHNTCEDSLLAAPIMLDL

Specifications

• Antigen: inositol-3-phosphate synthase 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ISYNA1.
• Gene: ISYNA1
• Gene Alias: INOS/IPS/Ino1
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 51477
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_016368
• Gene Symbols: ISYNA1
• Immunogen: ISYNA1 (NP_057452, 331 a.a. ∼ 430 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum