itchy E3 ubiquitin protein ligase homolog (mouse), Mouse, Clone: 1B8, Abnova™

Catalog No.	Quantity
89-001-365	100 μg

Catalog No. 89-001-365 Supplier Abnova Corporation Supplier No. H00083737M06

Description

Mouse monoclonal antibody raised against a partial recombinant ITCH.

Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. The protein encoded by this gene interacts with atrophin-1. This encoded protein is a closely related member of the NEDD4-like protein family. This family of proteins are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. This encoded protein contains four tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. It can act as a transcriptional corepressor of p45/NFE2 and may participate in the regulation of immune responses by modifying Notch-mediated signaling. It is highly similar to the mouse Itch protein, which has been implicated in the regulation and differentiation of erythroid and lymphoid cells. [provided by RefSeq

Sequence: DVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSESASQNDDGSRSKDETRVSTNGSDDPEDAGAGE

Specifications

• Antigen: itchy E3 ubiquitin protein ligase homolog (mouse)
• Applications: ELISA, Immunofluorescence
• Classification: Monoclonal
• Clone: 1B8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ITCH.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ITCH
• Gene Accession No.: NM_031483
• Gene Alias: AIF4/AIP4/NAPP1/dJ468O1.1
• Gene Symbols: ITCH
• Host Species: Mouse
• Immunogen: ITCH (NP_113671, 92 a.a. ∼ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Ubiquitin/Proteasome
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 83737
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ