integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ITGB3.

Supplier:  Abnova Corporation H00003690A01

Catalog No. 89-004-172

Description

The ITGB3 protein product is the integrin beta chain beta 3. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. Integrin beta 3 is found along with the alpha IIb chain in platelets. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. [provided by RefSeq

Sequence: GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDY

Specifications

• Antigen: integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ITGB3.
• Gene: ITGB3
• Gene Alias: CD61/GP3A/GPIIIa
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_000212
• Gene Symbols: ITGB3
• Immunogen: ITGB3 (NP_000203, 27 a.a. ∼ 136 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 3690
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.