eukaryotic translation initiation factor 6, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-173	50 μL

Catalog No. 89-004-173 Supplier Abnova Corporation Supplier No. H00003692A01

Description

Mouse polyclonal antibody raised against a partial recombinant ITGB4BP.

Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq

Sequence: VLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT

Specifications

• Antigen: eukaryotic translation initiation factor 6
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ITGB4BP.
• Formulation: 50% glycerol
• Gene: EIF6
• Gene Accession No.: NM_002212
• Gene Alias: 2/CAB/EIF3A/ITGB4BP/b/b(2)gcn/gcn/p27BBP
• Gene Symbols: EIF6
• Host Species: Mouse
• Immunogen: ITGB4BP (NP_002203, 146 a.a. ∼ 245 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3692
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum