Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IL2-inducible T-cell kinase (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No. 89004174 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-174 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-174 Supplier Abnova Corporation Supplier No. H00003702A01
Add to Cart
Add to Cart

Mouse polyclonal antibody raised against a partial recombinant ITK.

This gene encodes an intracellular tyrosine kinase expressed in T-cells. The protein contains both SH2 and SH3 domains which are often found in intracellular kinases. It is thought to play a role in T-cell proliferation and differentiation. [provided by RefSeq

Sequence: MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRIKCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETR

Specifications

Antigen IL2-inducible T-cell kinase
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant ITK.
Formulation 50% glycerol
Gene ITK
Gene Accession No. NM_005546
Gene Alias EMT/LYK/MGC126257/MGC126258/PSCTK2
Gene Symbols ITK
Host Species Mouse
Immunogen ITK (NP_005537, 1 a.a. ∼ 111 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 3702
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.