Janus kinase 1 (a protein tyrosine kinase), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-018-822	50 μL

Catalog No. 89-018-822 Supplier Abnova Corporation Supplier No. H00003716A01

Description

Mouse polyclonal antibody raised against a partial recombinant JAK1.

Janus kinase 1 (JAK1), is a member of a new class of protein-tyrosine kinases (PTK) characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain. The second phosphotransferase domain bears all the hallmarks of a protein kinase, although its structure differs significantly from that of the PTK and threonine/serine kinase family members. JAK1 is a large, widely expressed membrane-associated phosphoprotein. JAK1 is involved in the interferon-alpha/beta and -gamma signal transduction pathways. The reciprocal interdependence between JAK1 and TYK2 activities in the interferon-alpha pathway, and between JAK1 and JAK2 in the interferon-gamma pathway, may reflect a requirement for these kinases in the correct assembly of interferon receptor complexes. These kinases couple cytokine ligand binding to tyrosine phosphorylation of various known signaling proteins and of a unique family of transcription factors termed the signal transducers and activators of transcription, or STATs. [provided by RefSeq

Sequence: NLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMNWFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVV

Specifications

• Antigen: Janus kinase 1 (a protein tyrosine kinase)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant JAK1.
• Formulation: 50% glycerol
• Gene: JAK1
• Gene Accession No.: NM_002227
• Gene Alias: JAK1A/JAK1B/JTK3
• Gene Symbols: JAK1
• Host Species: Mouse
• Immunogen: JAK1 (NP_002218, 221 a.a. ∼ 320 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Gene ID (Entrez): 3716
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum