junctional adhesion molecule 3, Mouse, Clone: 1D3, Abnova™

Catalog No.	Quantity
89-001-364	100 μg

Catalog No. 89-001-364 Supplier Abnova Corporation Supplier No. H00083700M01

Description

Mouse monoclonal antibody raised against a partial recombinant JAM3.

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, the this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. The encoded protein is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family. [provided by RefSeq

Sequence: SNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELT*

Specifications

• Antigen: junctional adhesion molecule 3
• Applications: ELISA
• Classification: Monoclonal
• Clone: 1D3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant JAM3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: JAM3
• Gene Accession No.: NM_032801
• Gene Alias: FLJ14529/JAM-C/JAMC
• Gene Symbols: JAM3
• Host Species: Mouse
• Immunogen: JAM3 (NP_116190, 82 a.a. ∼ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 83700
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ