jumonji, AT rich interactive domain 1A, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant JARID1A.

Supplier:  Abnova Corporation H00005927A01

Catalog No. 89-004-278

Description

The protein encoded by this gene is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein which regulates cell proliferation. This protein also interacts with rhombotin-2 which functions distinctly in erythropoiesis and in T-cell leukemogenesis. Rhombotin-2 is thought to either directly affect the activity of the encoded protein or may indirectly modulate the functions of the retinoblastoma protein by binding to this protein. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq

Sequence: KVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNF

Specifications

• Antigen: jumonji, AT rich interactive domain 1A
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant JARID1A.
• Gene: JARID1A
• Gene Alias: KDM5A/RBBP2/RBP2
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_005056
• Gene Symbols: JARID1A
• Immunogen: JARID1A (NP_005047, 191 a.a. ∼ 290 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 5927
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.