jumonji, AT rich interactive domain 1A, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-278	50 μL

Catalog No. 89-004-278 Supplier Abnova Corporation Supplier No. H00005927A01

Description

Mouse polyclonal antibody raised against a partial recombinant JARID1A.

The protein encoded by this gene is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein which regulates cell proliferation. This protein also interacts with rhombotin-2 which functions distinctly in erythropoiesis and in T-cell leukemogenesis. Rhombotin-2 is thought to either directly affect the activity of the encoded protein or may indirectly modulate the functions of the retinoblastoma protein by binding to this protein. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq

Sequence: KVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNF

Specifications

• Antigen: jumonji, AT rich interactive domain 1A
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant JARID1A.
• Formulation: 50% glycerol
• Gene: JARID1A
• Gene Accession No.: NM_005056
• Gene Alias: KDM5A/RBBP2/RBP2
• Gene Symbols: JARID1A
• Host Species: Mouse
• Immunogen: JARID1A (NP_005047, 191 a.a. ∼ 290 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5927
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum