Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004519

jumping translocation breakpoint (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No. 89004519 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-519 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-519 Supplier Abnova Corporation Supplier No. H00010899A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a full-length recombinant JTB.

Sequence: MLAGAGRPGLPQGRHLCWLLCAFTLKLCQAEAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVIIRQRQLDRKALEKVRKQIESI

Specifications

Antigen jumping translocation breakpoint
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length recombinant JTB.
Formulation 50% glycerol
Gene JTB
Gene Accession No. BC000996
Gene Alias HJTB/HSPC222/PAR/hJT
Gene Symbols JTB
Host Species Mouse
Immunogen JTB (AAH00996.1, 1 a.a. ∼ 146 a.a) full-length recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Cell Adhesion
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 10899
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.