Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004176

Kallmann syndrome 1 sequence, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004176 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-176 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-176 Supplier Abnova Corporation Supplier No. H00003730A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant KAL1.

Mutations in this gene cause the X-linked Kallmann syndrome. The encoded protein is similar in sequence to proteins known to function in neural cell adhesion and axonal migration. In addition, this cell surface protein is N-glycosylated and may have anti-protease activity. [provided by RefSeq

Sequence: LAKPENLSASFIVQDVNITGHFSWKMAKANLYQPMTGFQVTWAEVTTESRQNSLPNSIISQSQILPSDHYVLTVPNLRPSTLYRLEVQVLTPGGEGPATIKTFRTPELPP

Specifications

Antigen Kallmann syndrome 1 sequence
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant KAL1.
Formulation 50% glycerol
Gene KAL1
Gene Accession No. NM_000216
Gene Alias ADMLX/HHA/KAL/KALIG-1/KMS
Gene Symbols KAL1
Host Species Mouse
Immunogen KAL1 (NP_000207, 548 a.a. ∼ 657 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Cell Adhesion
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 3730
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.